CDS

Accession Number TCMCG043C54598
gbkey CDS
Protein Id XP_022896005.1
Location 9711987..9712652
Gene LOC111410069
GeneID 111410069
Organism Olea europaea var. sylvestris

Protein

Length 221aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA417827
db_source XM_023040237.1
Definition very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like [Olea europaea var. sylvestris]

EGGNOG-MAPPER Annotation

COG_category I
Description Catalyzes the third of the four reactions of the long- chain fatty acids elongation cycle. This endoplasmic reticulum- bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates to the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators
KEGG_TC -
KEGG_Module M00415        [VIEW IN KEGG]
KEGG_Reaction R07760        [VIEW IN KEGG]
R10827        [VIEW IN KEGG]
KEGG_rclass RC00770        [VIEW IN KEGG]
RC01095        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko01004        [VIEW IN KEGG]
KEGG_ko ko:K10703        [VIEW IN KEGG]
EC 4.2.1.134        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko00062        [VIEW IN KEGG]
ko01040        [VIEW IN KEGG]
ko01110        [VIEW IN KEGG]
ko01212        [VIEW IN KEGG]
map00062        [VIEW IN KEGG]
map01040        [VIEW IN KEGG]
map01110        [VIEW IN KEGG]
map01212        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0006082        [VIEW IN EMBL-EBI]
GO:0006629        [VIEW IN EMBL-EBI]
GO:0006631        [VIEW IN EMBL-EBI]
GO:0006633        [VIEW IN EMBL-EBI]
GO:0006643        [VIEW IN EMBL-EBI]
GO:0006665        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008610        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016021        [VIEW IN EMBL-EBI]
GO:0016053        [VIEW IN EMBL-EBI]
GO:0016829        [VIEW IN EMBL-EBI]
GO:0016835        [VIEW IN EMBL-EBI]
GO:0016836        [VIEW IN EMBL-EBI]
GO:0018812        [VIEW IN EMBL-EBI]
GO:0019752        [VIEW IN EMBL-EBI]
GO:0030148        [VIEW IN EMBL-EBI]
GO:0030176        [VIEW IN EMBL-EBI]
GO:0030497        [VIEW IN EMBL-EBI]
GO:0031224        [VIEW IN EMBL-EBI]
GO:0031227        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032787        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043436        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044255        [VIEW IN EMBL-EBI]
GO:0044281        [VIEW IN EMBL-EBI]
GO:0044283        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046394        [VIEW IN EMBL-EBI]
GO:0046467        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0072330        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCCGGATTTTTCTCAAATTTCCGGCGAAGTTACCTCACAATCTACAATTGGACCGTATTCATCGGATGGTTACAAGTATTTTACCTTTCTGTGATGACGCTGAAACAATCCGGCCACGAACATGTCTACGCCACCGTTGAGAAGCCGCTGCTCTGGGCACAATCCGCTGCTGTATTCGAGATTCTACACGGCCTAATTGGATTGGTCAGATCTCCGGTCAGTGCTACGCTGCCCCAAATTAGCTCCAGATTGTACGTGGTGTGGGGGATTTTGTGGAGTTTTCCTGAACTAAGGACTCATTTTTTCGTGAGTTCACTGGTGATTAGTTGGTCAATTACTGAAATTATTCGATATTCGTTTTTCGGGTTGAAGGAAGCTTTTGGTTCTGCTCCATCCTGGCTGCTTTGGCTGAGGTACAGCACCTTTCTTATACTGTACCCTACGGGAATTTCAAGTGAAGTGGGTTTGACATACATTGCGCTGCCTTACATGAAGGAATCATTGAAATACAGTATAAGCATGCCTAACAAATGGAATTTTTCATTCGATTACTATTACTTGGCACTTGGGATTCTCGGCGTTTATGTTCCGGGAAGTCCTCATTTGTACGGATACATGCTTGGCCAGAGGAAAAAGGCACTTGCCAAAGCCAAAAGTGAGTAG
Protein:  
MAGFFSNFRRSYLTIYNWTVFIGWLQVFYLSVMTLKQSGHEHVYATVEKPLLWAQSAAVFEILHGLIGLVRSPVSATLPQISSRLYVVWGILWSFPELRTHFFVSSLVISWSITEIIRYSFFGLKEAFGSAPSWLLWLRYSTFLILYPTGISSEVGLTYIALPYMKESLKYSISMPNKWNFSFDYYYLALGILGVYVPGSPHLYGYMLGQRKKALAKAKSE